Total number of results for Lampetra fluviatilis are 7
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP03890 |
FPNKPDSPGEDAPAEDLARYLSAVRHYINLITRQRY
|
36 | Lampetra fluviatilis | NPY | Neuropeptide Y | ||
| NP03891 |
FPPKPDNPGDNASPEQMARYKAAVRHYINLITRQRY
|
36 | Lampetra fluviatilis | NPY | Peptide YY-like | ||
| NP05259 |
NRVYVHPFTL
|
10 | Lampetra fluviatilis | Serpin | Angiotensin I | 14993829#Rankin JC, Watanabe TX, Nakajima K, Broadhead C, Takei Y#Identification of angiotensin I in a cyclostome, Lampetra fluviatilis#Zoolog Sci 2004 Feb;21(2):173-9 | |
| NP05365 |
AGCKNFFWKTFTSC
|
14 | Lampetra fluviatilis | Somastostatin | Somatostatin 14 | 8575665#Conlon JM, Bondareva V, Rusakov Y, Plisetskaya EM, Mynarcik DC, Whittaker J#Characterization of insulin, glucagon, and somatostatin from the river lamprey, Lampetra fluviatilis#Gen Comp Endocrinol 1995 Oct;100(1):96-105 | |
| NP05380 |
AAAAPGAAGGAQLPLGNRERKAGCKNFFWKTFSSC
|
35 | Lampetra fluviatilis | Somastostatin | Somatostatin-35 | 8575665#Conlon JM, Bondareva V, Rusakov Y, Plisetskaya EM, Mynarcik DC, Whittaker J#Characterization of insulin, glucagon, and somatostatin from the river lamprey, Lampetra fluviatilis#Gen Comp Endocrinol 1995 Oct;100(1):96-105 | |
| NP05530 |
HKDAFIGLM
|
9 | Lampetra fluviatilis | Tachykinin | Neurokinin A | 7479293#Waugh D, Bondareva V, Rusakov Y, Bjenning C, Nielsen PF, Conlon JM#Tachykinins with unusual structural features from a urodele, the amphiuma, an elasmobranch, the hammerhead shark, and an agnathan, the river lamprey#Peptides 1995;16(4):615-21 | |
| NP05531 |
RKPHPKEFVGLM
|
12 | Lampetra fluviatilis | Tachykinin | Substance P | 7479293#Waugh D, Bondareva V, Rusakov Y, Bjenning C, Nielsen PF, Conlon JM#Tachykinins with unusual structural features from a urodele, the amphiuma, an elasmobranch, the hammerhead shark, and an agnathan, the river lamprey#Peptides 1995;16(4):615-21 |